LL-37 (Cathelicidin) Peptide
LL-37 (Cathelicidin) Peptide
$102.00 Buy Now

LL-37 (Cathelicidin) Peptide

$102.00

For Research Use Only. Not for human use. High-purity LL-37 (Cathelicidin, CAP-18), a synthetic 37-amino-acid antimicrobial peptide ([LL-37, 37 aa]), supports advanced pre-clinical investigations into innate immune defense, microbial membrane disruption, and inflammatory pathway modulation. Investigators utilize this compound to examine α-helical cationic interactions with bacterial membranes, chemotactic signaling, and epithelial barrier support in cellular and animal models. National Science Labs provides LL-37 exclusively for laboratory research exploring cathelicidin-mediated antimicrobial activity and tissue repair mechanisms in controlled experimental settings.

In stock

For Research Use Only — Not for Human Consumption
 

Free shipping on all orders over $200 (US)

  • 99% Purity – Third-Party Tested
  • Fast & Reliable Shipping
Guaranteed Checkout

For Research Use Only. Not for human use.

Researchers apply LL-37 to investigate its broad-spectrum activity against bacterial, viral, and fungal pathogens through direct membrane permeabilization and secondary immunomodulatory effects. Pre-clinical observations in epithelial cell cultures and infection models indicate promotion of immune cell chemotaxis, regulation of cytokine production, and acceleration of wound closure processes.

This cathelicidin peptide facilitates examination of innate defense mechanisms, biofilm disruption, and balanced inflammatory responses in models of microbial challenge or tissue injury.

Scientific Overview of LL-37 Applications

Pre-clinical models demonstrate LL-37’s engagement with antimicrobial and immunomodulatory pathways:

  • Disruption of microbial membranes through α-helical insertion and pore formation in bacterial and fungal systems. https://pubmed.ncbi.nlm.nih.gov/16716248/
  • Promotion of chemotaxis and recruitment of immune cells (neutrophils, monocytes) via receptor-mediated signaling in inflammatory models. https://pubmed.ncbi.nlm.nih.gov/22393864/
  • Modulation of cytokine expression, including upregulation of IL-8 and downregulation of excessive TNF-α in epithelial and macrophage cultures.
  • Acceleration of wound healing through enhanced re-epithelialization, angiogenesis, and collagen deposition in dermal injury models. https://pubmed.ncbi.nlm.nih.gov/25041740/
  • Support for investigations into biofilm eradication and antimicrobial synergy in chronic infection paradigms.
  • Examination of cathelicidin’s role in epithelial barrier integrity and innate immune coordination in mucosal systems.

For further details on cathelicidin peptides, antimicrobial signaling, and immune modulation pathways in pre-clinical research, refer to the Peptide Sciences or About Peptides sections.

Why Investigators Select National Science Labs LL-37

National Science Labs manufactures LL-37 under rigorous GMP-compliant protocols to ensure batch-to-batch consistency and reliability for pre-clinical experiments. Independent third-party testing verifies each lot for:

  • Purity ≥99.9% by HPLC
  • Structural identity confirmation via mass spectrometry
  • Complete Certificate of Analysis (CoA) documentation provided per batch

For Research Use Only. This product is supplied exclusively for in vitro and in vivo pre-clinical research by qualified investigators. Statements about this peptide have not been evaluated by the FDA.

Initiate Your LL-37 Research Protocol

Source high-purity LL-37 from current limited batches to ensure optimal stability and performance in antimicrobial and immune modulation studies.

Additional information

Weight.125 lbs
Dimensions9 × 7 × .5 in
Size

5mg, 10mg

Keep lyophilized peptides sealed in their original vial, protected from light and humidity, and store at -4°F or colder for optimal long-term stability in research settings; short-term refrigeration at around 39°F suffices for immediate use within weeks, though freezer storage maximizes integrity across extended research timelines.